CacheBy
Merck Anti-GANAB antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-GANAB antibody produced in rabbit

상품 한눈에 보기

토끼에서 생산된 Anti-GANAB polyclonal 항체로, 인간 단백질에 반응합니다. Prestige Antibodies® 라인 제품으로 affinity isolated 형태이며, 면역조직화학(IHC)에 적합합니다. −20°C에서 보관하며 wet ice 상태로 배송됩니다.

브랜드
Merck Sigma

Merck Sigma · Merck Anti-GANAB antibody produced in rabbit

Anti-GANAB antibody produced in rabbit

제품 개요

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution.

기본 정보

항목 내용
생물학적 소스 Rabbit
Quality Level 100
결합 Unconjugated
항체 형태 Affinity isolated antibody
항체 유형 Primary antibodies
클론 Polyclonal
제품 라인 Prestige Antibodies® Powered by Atlas Antibodies
제형 Buffered aqueous glycerol solution
Species Reactivity Human
포장 25 μL (small pack)
향상된 검증 Independent, Orthogonal RNAseq
적용 기술 Immunohistochemistry (IHC): 1:200–1:500
면역원 서열 AYQPFFRAHAHLDTGRREPWLLPSQHNDIIRDALGQRYSLLPFWYTLLYQAHREGIPVMRPLWVQYPQDVTTFNIDDQYLLGDALLVHPVSDSGAHGVQVYLPGQGEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQ
UniProt 수납 번호 Q14697
배송 상태 Wet ice
저장 온도 −20°C

유전자 정보

Gene: human GANAB (23193)

The gene, glucosidase II α subunit (GANAB), spanning a length of 21.9 kb, is mapped to human chromosome 11q23.2. The gene codes for the catalytic subunit of glucosidase II (GIIa). Glucosidase II is mainly expressed in the endoplasmic reticulum (ER) and transitional elements.

참고 링크

Merck Sigma 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.