
Merck Anti-PLEKHM1 antibody produced in rabbit
토끼에서 생산된 Anti-PLEKHM1 polyclonal 항체로, 인간 PLEKHM1 단백질을 특이적으로 인식합니다. Prestige Antibodies® 라인 제품으로 면역블롯 및 면역조직화학에 적합하며, −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-PLEKHM1 antibody produced in rabbit
Anti-PLEKHM1 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution, Ab2
생물학적 소스
rabbit
품질 등급
100
결합
unconjugated
항체 형태
affinity isolated antibody
항체 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
제형
buffered aqueous glycerol solution
반응 종
human
포장
small pack of 25 μL
향상된 검증
Recombinant expression 기반 검증
Antibody Enhanced Validation 관련 정보는 Merck 사이트에서 확인 가능
적용 기술
- Immunoblotting: 0.04–0.4 μg/mL
- Immunohistochemistry: 1:50–1:200
면역원 서열
LTASSLSLDTASSSQLSCSLNSDSCLLQENGSKSPDHCEEPMSCDSDLGTANAEDSDRSLQEVLLEFSKAQVNSVPTNGLSQETEIPTPQASLSLHGLNTSTYLHCEAP
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
human PLEKHM1 (9842)
PLEKHM1 (pleckstrin homology and RUN domain containing M1) 유전자는 인간 염색체 17q21.31에 위치하며, 세포질 및 후기 엔도좀/리소좀 구획에 널리 발현됩니다. 단백질은 RH (rubicon homologous) 도메인, 두 개의 PH (pleckstrin homology) 도메인, 그리고 LIR (LC3 interaction region)을 포함합니다.
제품 스펙 요약
| 항목 | 내용 |
|---|---|
| Biological source | Rabbit |
| Quality level | 100 |
| Conjugation | Unconjugated |
| Antibody form | Affinity isolated antibody |
| Type | Primary, Polyclonal |
| Product line | Prestige Antibodies® Powered by Atlas Antibodies |
| Formulation | Buffered aqueous glycerol solution |
| Species reactivity | Human |
| Package size | 25 μL |
| Validation | Recombinant expression |
| Techniques | Immunoblotting, Immunohistochemistry |
| Storage | −20°C |
| Shipping | Wet ice |
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



