
Merck Anti-GIMAP4 antibody produced in rabbit
Rabbit에서 생산된 Anti-GIMAP4 polyclonal antibody로, 인간 GIMAP4 단백질 검출에 적합. Prestige Antibodies® 라인으로 고품질 검증 완료. Immunoblotting 및 Immunohistochemistry에 사용 가능. −20°C에서 보관하며 wet ice로 배송.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Merck Sigma · Merck Anti-GIMAP4 antibody produced in rabbit
Anti-GIMAP4 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution, Ab2
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 형태 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 제형 | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 | 25 μL (small pack) |
| 향상된 검증 | Orthogonal RNAseq |
| Technique(s) | Immunoblotting: 0.04–0.4 μg/mL Immunohistochemistry: 1:200–1:500 |
| 면역원 서열 | MAAQYGSMSFNPSTPGASYGPGRQEPRNSQLRIVLVGKTGAGKSATGNSILGRKVFHSGTAAKSITKKCEKRSSSWKETELVVVDTPG |
| UniProt 수납 번호 | Q9NUV9 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
Gene Information
GIMAP4 (55303)
The gene GIMAP4 (GTPase IMAP family member 4) is mapped to human chromosome 7q36. It belongs to the GIMAP family of proteins. The protein localizes mainly in the cytoplasm, but is also present in the endoplasmic reticulum and Golgi. GIMAP4 is strongly expressed in spleen and peripheral blood leukocytes containing mainly B and T lymphocytes. It is also present in thymus, small intestine, colon, and ovary. GIMAP4 is also referred to as IAN1 (immunity-associated nucleotide 1).
제품 이미지
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



