
Merck Anti-GIMAP4 antibody produced in rabbit
Merck의 Anti-GIMAP4 rabbit polyclonal antibody로, 인간 GIMAP4 단백질을 특이적으로 인식. Prestige Antibodies® 제품군으로 고품질 검증(orthogonal RNAseq, recombinant expression) 완료. Western blot 및 IHC에 적합하며 −20°C에서 보관.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Merck Sigma · Merck Anti-GIMAP4 antibody produced in rabbit
Anti-GIMAP4 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution, Ab1
제품 개요
Rabbit에서 생산된 Anti-GIMAP4 항체로, 인간 GIMAP4 단백질을 인식하는 polyclonal primary antibody입니다. Atlas Antibodies의 Prestige Antibodies® 라인으로, 향상된 검증(Enhanced Validation)을 거쳐 높은 신뢰성을 제공합니다.
제품 사양
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Quality Level | 100 |
| Conjugation | Unconjugated |
| Antibody Form | Affinity isolated antibody |
| Product Type | Primary antibodies |
| Clone | Polyclonal |
| Product Line | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| Packaging | 25 μL (small pack) |
| Validation | Orthogonal RNAseq, recombinant expression, independent |
| Techniques | Immunoblotting: 0.04–0.4 μg/mL Immunohistochemistry: 1:1000–1:2500 |
| Immunogen Sequence | EDIQDLMDIFGDRYCALNNKATGAEQEAQRAQLLGLIQRVVRENKEGCYTNRMYQRAEEEIQKQTQAMQELHRVELE |
| UniProt Accession | Q9NUV9 |
| Shipping Condition | Wet ice |
| Storage Temperature | −20°C |
Gene Information
Human GIMAP4 (55303)
The gene GIMAP4 (GTPase IMAP family member 4) is located on human chromosome 7q36 and belongs to the GIMAP family of proteins. The protein is mainly localized in the cytoplasm, with presence in the endoplasmic reticulum and Golgi apparatus. GIMAP4 is highly expressed in spleen and peripheral blood leukocytes (B and T lymphocytes), and also found in thymus, small intestine, colon, and ovary. It is also known as IAN1 (immunity-associated nucleotide 1).
제품 이미지
(이미지 없음)
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



