| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA015278-100UL | - | Merck HPA015278-100UL Anti-AQP6 antibody produced in rabbit, 100uL pk | 재고문의 | pk | 951,160원 | - | 1,046,276원 | |
Anti-AQP6 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunohistochemistry: 1:200-1:500
면역원 서열
PDTKTLAQRLAILTGTVEVGTGAGAGAEPLKKESQPGSGAVEME
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... AQP6(363)
AQP6 (aquaporin 6) is a membrane protein residing in the intracellular vesicles. It resides in the human inner ear, and the renal collecting ducts in the acid-secreting intercalated cells. This gene is localized to human chromosome 12q13. The encoded protein is composed of 282 amino acids, and has a molecular weight of 29kDa. It contains the NPA (asparagine-proline-alanine) motifs, which are conserved in nature and characteristic of MIP (major intrinsic protein) family.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|