AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-CREG2 antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 CREG2 단백질에 대한 polyclonal 항체로, Atlas Antibodies의 Prestige Antibodies® 라인 제품입니다. 인간 단백질에 반응하며 면역조직화학(IHC)에 적합합니다. 정제된 항체로 glycerol buffer 용액 형태이며, −20°C에서 보관합니다.
- 카탈로그번호
- HPA038224-100UL
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:41
카탈로그 번호 · 상품 설명출고판매가담기
Merck HPA038224-100UL Anti-CREG2 antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
895,600원VAT 포함 985,160원
Merck Sigma · Merck Anti-CREG2 antibody produced in rabbit
Anti-CREG2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 정보
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Quality Level | 100 |
| Conjugate | Unconjugated |
| Antibody Type | Primary antibodies |
| Clonality | Polyclonal |
| Product Line | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| Packaging | Small pack of 25 μL |
| Validated Application | Orthogonal RNAseq (Enhanced Validation) |
| Technique(s) | Immunohistochemistry (1:50–1:200) |
| Immunogen Sequence | RCVQLTLTGQMIAVSPEEVEFAKQAMFSRHPGMRKWPRQYEWFFMKMRIEHIWLQKWYGGASSISREEYFKAVP |
| UniProt Accession No. | Q8IUH2 |
| Shipping Conditions | Wet ice |
| Storage Temperature | −20 °C |
| Gene Information | Human CREG2 (200407) — Cellular repressor of E1A-stimulated genes 2 recombinant protein epitope signature tag (PrEST) |
추가 정보
Learn more about Antibody Enhanced Validation
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.