
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-VPS37B antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-VPS37B 다클론 항체로, rat, human, mouse에 반응합니다. Prestige Antibodies® 제품군으로 높은 품질의 affinity isolated antibody입니다. Western blot 및 IHC에 적합하며 −20°C에서 보관합니다.
- 카탈로그번호
- HPA038217-100UL
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:41
카탈로그 번호 · 상품 설명출고판매가담기
Merck HPA038217-100UL Anti-VPS37B antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
920,800원VAT 포함 1,012,880원
Merck Sigma · Merck Anti-VPS37B antibody produced in rabbit
Anti-VPS37B antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 개요
The ESCRT-I (endosomal sorting complex required for transport) is a 350 kDa protein complex with four subunits (TSG101, VPS28, VPS37, and MVB12). VPS37 exists in four isoforms. Vacuolar protein sorting 37 homolog B (VPS37B) is located on human chromosome 12q24.31.
제품 사양
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 형태 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| Antibody Product Type | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태(Form) | Buffered aqueous glycerol solution |
| Species Reactivity | Rat, Human, Mouse |
| 포장 단위 | Small pack of 25 μL |
| 향상된 검증 | Independent (Antibody Enhanced Validation) |
| Technique(s) | Immunoblotting: 0.04–0.4 μg/mL Immunohistochemistry: 1:50–1:200 |
| 면역원 서열 | IEEDTENMAEKFLDGELPLDSFIDVYQSKRKLAHMRRVKIEKLQEMVLKGQRLPQALAPLPPRLPELAPTAPLPYPAP |
| UniProt 수납 번호 | Q9H9H4 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
| Gene Information | Human VPS37B (79720) |
제품 이미지
(이미지 없음)
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



