AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-TMEM119 antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-TMEM119 항체로, 인간 TMEM119 단백질을 인식하는 polyclonal 1차 항체입니다. Prestige Antibodies® 시리즈로 고품질 검증 완료. 면역조직화학(IHC)에 적합하며, −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:39
카탈로그 번호 · 상품 설명출고판매가담기
Merck HPA051870-25UL Anti-TMEM119 antibody produced in rabbit, 25uL pk판매 단위 pk ·
재고 확인 필요
견적요청
Merck Sigma · Merck Anti-TMEM119 antibody produced in rabbit
Anti-TMEM119 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 정보
| 항목 | 내용 |
|---|---|
| Biological source | Rabbit |
| Quality level | 100 |
| Conjugation | Unconjugated |
| Antibody form | Affinity isolated antibody |
| Antibody product type | Primary antibodies |
| Clone | Polyclonal |
| Product line | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species reactivity | Human |
| Packaging | Small pack, 25 μL |
| Enhanced validation | Independent, orthogonal RNAseq |
| Technique(s) | Immunohistochemistry (IHC): 1:500–1:1000 |
| Immunogen sequence | GDGARMVEGRGAEEEEKGSQEGDQEVQGHGVPVETPEAQEEPCSGVLEGAVVAGEGQGELEGSLLLAQEAQGPVGPPESPCACSSVHPS |
| UniProt accession no. | Q4V9L6 |
| Shipping conditions | Wet ice |
| Storage temperature | −20 °C |
Gene Information
Gene: TMEM119 (338773)
Organism: Human
Transmembrane protein 119 (TMEM119) is encoded by the gene mapped to human chromosome 12q23.3.
The encoded protein belongs to the transmembrane protein family and has an O-glycosylated N-terminal region.
참고 링크
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.