CacheBy
Atlas Antibodies Anti-TCTN1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TCTN1 Antibody

상품 한눈에 보기

인간 TCTN1 단백질을 인식하는 폴리클로날 항체로, 면역조직화학 등 다양한 연구용 응용에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 인간에 대해 검증된 반응성을 가지며, 버퍼는 PBS와 글리세롤 기반입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA040036-100 Anti-TCTN1 Antibody, tectonic family member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040036-25 Anti-TCTN1 Antibody, tectonic family member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TCTN1 Antibody

Anti-TCTN1 Antibody

Target: tectonic family member 1 (TCTN1)
Supplier: Atlas Antibodies


면역조직화학 (IHC)


Product Description

Polyclonal antibody against human TCTN1.


Alternative Gene Names

FLJ21127, JBTS13, TECT1

Open Datasheet


Target Information

항목 내용
Target Protein tectonic family member 1
Target Gene TCTN1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence VPLSGNPGYVVGLPLAAGFQPHKGSGIIQTTNRYGQLTILHSTTEQDCLALEGVRTPVLFGYTMQSGCKLRLTGALPCQLVAQ

Verified Species Reactivity

Human


Interspecies Information

Highest antigen sequence identity to the following orthologs:

유전자 ID 항원 서열 동일성
Mouse ENSMUSG00000038593 81%
Rat ENSRNOG00000028523 80%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.