CacheBy
Atlas Antibodies Anti-TCTEX1D4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TCTEX1D4 Antibody

상품 한눈에 보기

Human TCTEX1D4 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 RNA-seq 데이터 기반의 정교한 Orthogonal 검증을 통해 단백질 발현을 확인함. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA062652-100 Anti-TCTEX1D4 Antibody, Tctex1 domain containing 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062652-25 Anti-TCTEX1D4 Antibody, Tctex1 domain containing 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TCTEX1D4 Antibody

Anti-TCTEX1D4 Antibody

Target Information

  • Target Protein: Tctex1 domain containing 4
  • Target Gene: TCTEX1D4
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    SRRNSLVGPGAGPGGQRPSLGPVPPLGSRVSFSGLPLAPARWVAPSYRTEPVPGERWEAARAQRAME

Product Description

Polyclonal antibody against human TCTEX1D4.

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000018463 81%
Mouse ENSMUSG00000047671 79%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet
Material Safety Data Sheet


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.