Atlas Antibodies Anti-TCP11L2 Antibody

상품 한눈에 보기

Human TCP11L2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC 및 Western blot에 적합하며, PrEST 항원으로 특이적으로 정제되었습니다. Human에 반응성이 검증되었습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA042188-100 Anti-TCP11L2 Antibody, t-complex 11, testis-specific-like 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA042188-25 Anti-TCP11L2 Antibody, t-complex 11, testis-specific-like 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: t-complex 11, testis-specific-like 2
Supplier: Atlas Antibodies

Polyclonal antibody against Human TCP11L2.

항목	내용
Target Protein	t-complex 11, testis-specific-like 2
Target Gene	TCP11L2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Homology	Rat ENSRNOG00000007587 (81%), Mouse ENSMUSG00000020034 (81%)

Antigen Sequence:

ACLSLITNNMVGAITGGLPELASRLTRISAVLLEGMNKETFNLKEVLNSIGIQTCVEVNKTLMERGLPTLNAEIQ

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Safety Data Sheet	Material Safety Data Sheet