
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TCTA Antibody
상품 한눈에 보기
Human TCTA 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. 40% glycerol 기반 PBS buffer에 보존되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA007342-100 Anti-TCTA Antibody, T-cell leukemia translocation altered 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007342-25 Anti-TCTA Antibody, T-cell leukemia translocation altered 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TCTA Antibody
Anti-TCTA Antibody
Target: T-cell leukemia translocation altered (TCTA)
Host: Rabbit
Clonality: Polyclonal
Applications: IHC, ICC
Product Description
Polyclonal antibody against human TCTA protein.
Validated for use in immunohistochemistry (IHC) and immunocytochemistry (ICC).
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | T-cell leukemia translocation altered |
| Target Gene | TCTA |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | AESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000048237 (84%), Mouse ENSMUSG00000039461 (81%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



