
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TAS2R38 Antibody
상품 한눈에 보기
Human TAS2R38 단백질을 인식하는 토끼 유래 폴리클로날 항체. PrEST 항원으로 친화 정제됨. 인간에 대한 반응성이 검증되었으며, 미각 수용체 연구에 적합. 40% 글리세롤/PBS 완충액에 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA043862-100 Anti-TAS2R38 Antibody, taste receptor, type 2, member 38 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043862-25 Anti-TAS2R38 Antibody, taste receptor, type 2, member 38 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TAS2R38 Antibody
Anti-TAS2R38 Antibody
Target Information
- Target Protein: Taste receptor, type 2, member 38
- Target Gene: TAS2R38
- Alternative Gene Names: PTC, T2R61
Product Description
Polyclonal antibody against Human TAS2R38.
Recommended Applications
IHC (Immunohistochemistry)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
SLGRHMRTMKVYTRNSRDPSLEAHIKALKS
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat (ENSRNOG00000026225): 70%
- Mouse (ENSMUSG00000058250): 67%
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Material Safety Data Sheet
Open Datasheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



