CacheBy
Atlas Antibodies Anti-TAS1R1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TAS1R1 Antibody

상품 한눈에 보기

Human TAS1R1 단백질을 인식하는 토끼 폴리클로날 항체로, 미각 수용체 관련 연구에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. IHC 등 다양한 응용에 사용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA034579-100 Anti-TAS1R1 Antibody, taste receptor, type 1, member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034579-25 Anti-TAS1R1 Antibody, taste receptor, type 1, member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TAS1R1 Antibody

Anti-TAS1R1 Antibody

Overview

Polyclonal antibody against Human TAS1R1 (taste receptor, type 1, member 1).

  • Immunohistochemistry (IHC)

Product Description

This polyclonal antibody targets the human TAS1R1 protein, a member of the type 1 taste receptor family.

Alternative Gene Names

GPR70, T1R1, TR1

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein taste receptor, type 1, member 1
Target Gene TAS1R1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LSRHITGVPGIQRIGMVLGVAIQKRAVPGLKAFEEAYARADKEAPRPCHKGSWCSSNQLCRECQAFMAHTMPKLKAFSMSSAYNAYRAVYAVAH

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000028950): 68%
  • Rat (ENSRNOG00000009708): 65%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.