CacheBy
Atlas Antibodies Anti-TARSL2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TARSL2 Antibody

상품 한눈에 보기

Human TARSL2 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC에 적합합니다. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 정제되었습니다. 높은 인간 특이성과 타종 교차 반응 정보 제공. 연구용으로 최적화된 고품질 항체.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA066697-100 Anti-TARSL2 Antibody, threonyl-tRNA synthetase-like 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA066697-25 Anti-TARSL2 Antibody, threonyl-tRNA synthetase-like 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TARSL2 Antibody

Anti-TARSL2 Antibody

Target Protein: threonyl-tRNA synthetase-like 2
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human TARSL2.

Alternative Gene Names

  • FLJ25005

Open Datasheet (PDF)

Target Information

  • Target Gene: TARSL2
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    VIPVGPTCEKYALQVSSEFFEEGFMADVDLDHSCTL

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Antigen Sequence Identity
Mouse ENSMUSG00000030515 86%
Rat ENSRNOG00000019023 58%

Antibody Specifications

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.