CacheBy
Atlas Antibodies Anti-TARS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TARS2 Antibody

상품 한눈에 보기

Human TARS2 단백질을 인식하는 rabbit polyclonal 항체로, IHC, WB, ICC에 적합. 고순도 affinity purification 방식으로 제조되었으며, Human, Mouse, Rat 종에 반응. 미토콘드리아 threonyl-tRNA synthetase 2 연구에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028626-100 Anti-TARS2 Antibody, threonyl-tRNA synthetase 2, mitochondrial (putative) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028626-25 Anti-TARS2 Antibody, threonyl-tRNA synthetase 2, mitochondrial (putative) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TARS2 Antibody

Anti-TARS2 Antibody

Target: threonyl-tRNA synthetase 2, mitochondrial (putative)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human TARS2.


Alternative Gene Names

  • FLJ12528
  • TARSL1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein threonyl-tRNA synthetase 2, mitochondrial (putative)
Target Gene TARS2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence HSSTHVLGAAAEQFLGAVLCRGPSTEYGFYHDFFLGKERTIRGSELPVLERICQELTAAARPFRRLEASRDQLRQLFKDNPFKLHLIE

Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information:
Highest antigen sequence identity to orthologs:

  • Mouse ENSMUSG00000028107 (89%)
  • Rat ENSRNOG00000057194 (82%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.