AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TAPT1 Antibody
상품 한눈에 보기
인간 TAPT1 단백질을 인식하는 토끼 폴리클로날 항체. 면역조직화학(IHC) 등 다양한 응용에 적합. PrEST 항원을 이용한 친화정제. 인간에 특이적이며, 생물학적 연구용으로 권장.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA042567-100 Anti-TAPT1 Antibody, transmembrane anterior posterior transformation 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042567-25 Anti-TAPT1 Antibody, transmembrane anterior posterior transformation 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TAPT1 Antibody
Anti-TAPT1 Antibody
Target: transmembrane anterior posterior transformation 1 (TAPT1)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human TAPT1, suitable for research use.
Recommended for applications such as immunohistochemistry (IHC).
Alternative Gene Names
- FLJ90013
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | transmembrane anterior posterior transformation 1 |
| Target Gene | TAPT1 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | EEKLSNPPATCTPGKPSSKSQNKCKPSQGLSTEENLSASITKQPIHQKENIIPLLVTSNSDQFLTTPDGDEKDITQDNSELKHRSSKKD |
Species Reactivity
- Verified: Human
- Ortholog Identity: Mouse (88%), Rat (87%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide as preservative
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.