CacheBy
Atlas Antibodies Anti-TAPT1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TAPT1 Antibody

상품 한눈에 보기

인간 TAPT1 단백질을 인식하는 폴리클로날 항체로, 면역조직화학(IHC) 등 다양한 연구 응용에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대한 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA048658-100 Anti-TAPT1 Antibody, transmembrane anterior posterior transformation 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048658-25 Anti-TAPT1 Antibody, transmembrane anterior posterior transformation 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TAPT1 Antibody

Anti-TAPT1 Antibody

Target Protein: transmembrane anterior posterior transformation 1 (TAPT1)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human TAPT1 protein.

Alternative Gene Names

  • FLJ90013

Open Datasheet


Target Information

항목 내용
Target Protein transmembrane anterior posterior transformation 1
Target Gene TAPT1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Mouse (88%), Rat (87%)

Antigen Sequence:
EEKLSNPPATCTPGKPSSKSQNKCKPSQGLSTEENLSASITKQPIHQKENIIPLLVTSNSDQFLTTPDGDEKDITQDNSELKHRSSKKD


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

  • Immunohistochemistry (IHC)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.