
원본
Thermo Fisher Scientific GDF9 (Growth Differentiation Factor 9) Monoclonal Antibody (GDF9/4261)
상품 한눈에 보기
GDF9 단백질을 인식하는 마우스 단클론 항체로, Western blot, IHC, ELISA 등에 사용 가능. 인간 시료에 반응하며, Protein A/G로 정제된 액상 형태. -20°C에서 보관하며 동결·해동 반복은 피해야 함.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 02. 오후 06:07
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific 2661-MSM1-P1ABX GDF9 (Growth Differentiation Factor 9) Monoclonal Antibody (GDF9/4261) 100 ug pk판매 단위 pk ·
재고 확인 필요
900,300원VAT 포함 990,330원
Thermo Fisher Scientific · Thermo Fisher Scientific GDF9 (Growth Differentiation Factor 9) Monoclonal Antibody (GDF9/4261)
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1–2 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | Assay-dependent |
| Immunohistochemistry (PFA fixed) (IHC (PFA)) | 1–2 µg/mL |
| ELISA | Assay-dependent |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Clone | GDF9/4261 |
| Immunogen | Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF9. |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 1 mg/mL |
| Purification | Protein A/G |
| Storage Buffer | PBS, pH 7.4 |
| Contains | No preservative |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Target Information
GDF9 (Growth Differentiation Factor 9)는 BMP(bone morphogenetic protein) 계열 및 TGF-beta 슈퍼패밀리에 속하는 단백질입니다. 이 단백질군은 폴리염기성 프로테아제 절단 부위를 가지며, 절단 후 7개의 보존된 시스테인 잔기를 포함하는 성숙 단백질을 형성합니다.
GDF9는 난소의 체세포에서 합성되는 성장 인자로, 난자의 성장과 기능에 직접적인 영향을 미치며, 난포형성(ovarian folliculogenesis)에 필수적인 역할을 하는 것으로 알려져 있습니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.

