CacheBy
Atlas Antibodies Anti-SYCP2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SYCP2 Antibody

상품 한눈에 보기

Human SYCP2 단백질을 인식하는 토끼 유래 폴리클로날 항체로, 면역세포화학 등 다양한 연구용 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. 버퍼는 PBS와 글리세롤 기반입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA065613-100 Anti-SYCP2 Antibody, synaptonemal complex protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065613-25 Anti-SYCP2 Antibody, synaptonemal complex protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SYCP2 Antibody

Anti-SYCP2 Antibody

Target: Synaptonemal complex protein 2 (SYCP2)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human SYCP2.


Alternative Gene Names

  • SCP2

Target Information

항목 내용
Target Protein Synaptonemal complex protein 2
Target Gene SYCP2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Ortholog Identity Rat ENSRNOG00000061690 (69%), Mouse ENSMUSG00000060445 (66%)

Antigen Sequence:
TTFVNVTSECPVNDVYNFNLNGADDPIIKLGIQEFQATAKEACADRSIRLVGPRNHDELKSSVKTKDKKIITNHQKKNLFSDTETEYRCDDSKTDISW


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

  • Immunocytochemistry (ICC)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Information

Open Datasheet (PDF)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.