CacheBy
Atlas Antibodies Anti-SYCN Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SYCN Antibody

상품 한눈에 보기

Human SYCN 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 단백질 발현 분석에 적합. Orthogonal validation으로 RNA-seq 데이터와 비교 검증됨. PrEST 항원을 이용해 Affinity 정제되었으며, 40% glycerol 기반 완충액에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047654-100 Anti-SYCN Antibody, syncollin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047654-25 Anti-SYCN Antibody, syncollin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SYCN Antibody

Anti-SYCN Antibody

Target Information

  • Target Protein: syncollin
  • Target Gene: SYCN
  • Alternative Gene Names: FLJ27441, INSSA1, SYL

Product Description

Polyclonal antibody against Human SYCN.

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    TASSLVVAPRCELTVWSRQGKAGKTHKFSAGTYPRLEEYRRGILGDWSNAISALYCRCP

Species Reactivity

  • Verified Species Reactivity: Human
  • Interspecies Information:
    • Mouse ENSMUSG00000084174 (75%)
    • Rat ENSRNOG00000019879 (71%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.