CacheBy
Atlas Antibodies Anti-SQRDL Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SQRDL Antibody

상품 한눈에 보기

인간 SQRDL 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. RNA-seq 데이터 기반의 정교한 직교 검증 수행. 고순도의 친화정제 항체로 높은 특이성과 재현성을 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA017079-100 Anti-SQRDL Antibody, sulfide quinone reductase-like (yeast) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017079-25 Anti-SQRDL Antibody, sulfide quinone reductase-like (yeast) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SQRDL Antibody

Anti-SQRDL Antibody

Target: sulfide quinone reductase-like (yeast)
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data from tissues with high and low expression.
  • WB (Orthogonal validation): Protein expression validated by comparison to RNA-seq data from cell lines with high and low expression.
  • ICC: Immunocytochemistry application supported.

Product Description

Polyclonal antibody against human SQRDL.


Alternative Gene Names

  • CGI-44

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein sulfide quinone reductase-like (yeast)
Target Gene SQRDL
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence TSPVADAAGWVDVDKETLQHRRYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTISVIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYLMKADLMPFLYWNMMLRGYWG
Verified Species Reactivity Human, Mouse
Interspecies Information Rat ENSRNOG00000000172 (93%), Mouse ENSMUSG00000005803 (89%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Orthogonal Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.