CacheBy
Atlas Antibodies Anti-SRA1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SRA1 Antibody

상품 한눈에 보기

Human SRA1 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제됨. IHC 등 다양한 연구용 응용에 적합하며, 40% glycerol 기반 PBS buffer에 보존됨. Mouse 및 Rat과 높은 서열 유사성을 보임.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050153-100 Anti-SRA1 Antibody, steroid receptor RNA activator 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050153-25 Anti-SRA1 Antibody, steroid receptor RNA activator 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SRA1 Antibody

Anti-SRA1 Antibody

Target: Steroid receptor RNA activator 1 (SRA1)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human SRA1 protein.

Alternative Gene Names

SRA, STRAA1

  • Immunohistochemistry (IHC)

Target Information

항목 내용
Target Protein Steroid receptor RNA activator 1
Target Gene SRA1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000006050 (81%), Rat ENSRNOG00000018089 (80%)

Antigen Sequence:

AEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSPGP

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.