AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SOCS4 Antibody
상품 한눈에 보기
Human SOCS4 단백질을 인식하는 Rabbit Polyclonal 항체로, cytokine signaling 억제 단백질 연구에 적합합니다. Affinity purification 방식으로 제조되었으며, ICC 등 다양한 응용에 사용 가능합니다. Glycerol 기반 안정화 버퍼 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA057961-100 Anti-SOCS4 Antibody, suppressor of cytokine signaling 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057961-25 Anti-SOCS4 Antibody, suppressor of cytokine signaling 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SOCS4 Antibody
Anti-SOCS4 Antibody
Target: Suppressor of Cytokine Signaling 4 (SOCS4)
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human SOCS4 protein.
Alternative Gene Names
- SOCS7
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Suppressor of Cytokine Signaling 4 |
| Target Gene | SOCS4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GYVWSGKKLSWSKKSESYSDAETVNGIEKTEVSLRNQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSS |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000048379 | 80% |
| Rat | ENSRNOG00000011377 | 78% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.