CacheBy
Atlas Antibodies Anti-SOCS3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SOCS3 Antibody

상품 한눈에 보기

Human SOCS3 단백질을 인식하는 rabbit polyclonal antibody. Affinity purification으로 높은 특이성과 재현성 확보. 면역세포 신호 조절 연구에 적합. Human 대상 반응 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA068569-100 Anti-SOCS3 Antibody, suppressor of cytokine signaling 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA068569-25 Anti-SOCS3 Antibody, suppressor of cytokine signaling 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SOCS3 Antibody

Anti-SOCS3 Antibody

Target: Suppressor of Cytokine Signaling 3 (SOCS3)
Supplier: Atlas Antibodies


면역세포 내 SOCS3 단백질 검출 및 세포 신호 연구에 적합합니다.
(ICC 등 세포 수준 분석에 활용 가능)


Product Description

Polyclonal antibody against human SOCS3.


Alternative Gene Names

CIS3, Cish3, SOCS-3, SSI-3


Target Information

  • Target Protein: Suppressor of Cytokine Signaling 3
  • Target Gene: SOCS3
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
FPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL

Verified Species Reactivity

Human


Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000053113 93%
Rat ENSRNOG00000002946 91%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen

Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야별 최적 농도 및 조건은 사용자가 실험적으로 결정해야 합니다.

Open Datasheet


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.