CacheBy
Atlas Antibodies Anti-SNX21 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SNX21 Antibody

상품 한눈에 보기

Human SNX21 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC 및 ICC 실험에 적합하며, PrEST 항원으로 친화 정제되었습니다. Human에 대해 검증된 반응성을 가지며, 보존용 PBS와 글리세롤 버퍼를 포함합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA046359-100 Anti-SNX21 Antibody, sorting nexin family member 21 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046359-25 Anti-SNX21 Antibody, sorting nexin family member 21 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SNX21 Antibody

Anti-SNX21 Antibody

Target Protein: Sorting nexin family member 21
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SNX21.


Alternative Gene Names

C20orf161, dJ337O18.4, SNX-L

Open Datasheet


Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

RAQSLTCTGLYREALALWANAWQLQAQLGTPSGPDRPLLTLAGLAVCHQELEDPGEARACCEKALQLLGDKSLHPLLAPFLEAHVRLSWRLGLDKRQSEA

Verified Species Reactivity

Human


Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000053247 95%
Mouse ENSMUSG00000050373 95%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.