CacheBy
Atlas Antibodies Anti-SNX24 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SNX24 Antibody

상품 한눈에 보기

Human SNX24 단백질을 인식하는 Polyclonal Rabbit IgG 항체로, Affinity purification 방식으로 정제됨. IHC 등 다양한 응용에 적합하며, 높은 종간 서열 일치도를 보유. 안정적인 PBS/glycerol buffer에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA044566-100 Anti-SNX24 Antibody, sorting nexin 24 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044566-25 Anti-SNX24 Antibody, sorting nexin 24 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SNX24 Antibody

Anti-SNX24 Antibody

Target Information

  • Target Protein: Sorting Nexin 24
  • Target Gene: SNX24
  • Alternative Gene Names: SBBI31
  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human SNX24.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GLETYLQAVILENEELPKLFLDFLNVRHLPSLPKAESCGSFDETESEESSKLSHQPVLLFLRDPYVLPAASDFPNVVIEGVLHGIFYPHLQPR

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000017488): 97%
  • Mouse (ENSMUSG00000024535): 97%

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.