CacheBy
Atlas Antibodies Anti-SNX17 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SNX17 Antibody

상품 한눈에 보기

Human SNX17 단백질을 표적으로 하는 rabbit polyclonal 항체. Affinity purified 방식으로 높은 특이성과 재현성을 제공. ICC 등 다양한 응용에 적합. 40% glycerol 기반 buffer로 안정적 보관 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA043867-100 Anti-SNX17 Antibody, sorting nexin 17 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043867-25 Anti-SNX17 Antibody, sorting nexin 17 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SNX17 Antibody

Anti-SNX17 Antibody

Target Protein: Sorting Nexin 17 (SNX17)
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SNX17.


Alternative Gene Names

  • KIAA0064

Open Datasheet


Target Information

항목 내용
Target Protein Sorting Nexin 17
Target Gene SNX17
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000029146 (97%), Rat ENSRNOG00000026884 (96%)

Antigen Sequence:
GTLRRSDSQQAVKSPPLLESPDATRESMVKLSSKLSAVSLRGIGSPSTDASASDVHGNFAFEGIGDEDL


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.