CacheBy
Atlas Antibodies Anti-SNX18 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SNX18 Antibody

상품 한눈에 보기

Human SNX18 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 실험에 적합합니다. siRNA knockdown을 통한 유전적 검증 완료. PrEST 항원을 이용해 친화 정제되었으며, 인간, 마우스, 랫트 반응성이 확인되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA037800-100 Anti-SNX18 Antibody, sorting nexin 18 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037800-25 Anti-SNX18 Antibody, sorting nexin 18 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SNX18 Antibody

Anti-SNX18 Antibody

Target: sorting nexin 18 (SNX18)
Supplier: Atlas Antibodies

  • IHC (Immunohistochemistry)
  • WB (Western Blot, genetically validated by siRNA knockdown)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human SNX18.

Alternative Gene Names

SH3PX2, SH3PXD3B, SNAG1

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein sorting nexin 18
Target Gene SNX18
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence DDEWDDSSTVADEPGALGSGAYPDLDGSSSAGVGAAGRYRLSTRSDLSLGSRGGSVPPQHHPSGPKSSATVSRNLN

Verified Species Reactivity

Human, Mouse, Rat

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000042364 91%
Rat ENSRNOG00000010971 91%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Application
Genetic Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.