CacheBy
Atlas Antibodies Anti-SNX16 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SNX16 Antibody

상품 한눈에 보기

Human SNX16 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 WB에 적합하며, Human, Mouse, Rat에 반응. PrEST 항원으로 친화 정제됨. 안정적인 PBS/glycerol buffer에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA024817-100 Anti-SNX16 Antibody, sorting nexin 16 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024817-25 Anti-SNX16 Antibody, sorting nexin 16 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SNX16 Antibody

Anti-SNX16 Antibody

Target Information

  • Target Protein: Sorting Nexin 16
  • Target Gene: SNX16
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    FPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDSLEESRAFCETLEETNYRLQKELLEKQKEMESL

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information:
Highest antigen sequence identity to orthologs:

  • Rat ENSRNOG00000009953 (97%)
  • Mouse ENSMUSG00000027534 (96%)

Product Description

Polyclonal antibody against Human SNX16.

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Storage Store at recommended conditions; gently mix before use
Safety Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Open Datasheet

제품 이미지

Recommended for IHC
Recommended for WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.