CacheBy
Atlas Antibodies Anti-SNX14 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SNX14 Antibody

상품 한눈에 보기

Human SNX14 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC 및 WB 실험에 적합. Rabbit host 기반 IgG 형식으로 제작. PrEST 항원으로 친화 정제되어 높은 특이성 보유. Human, Mouse, Rat 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA017639-100 Anti-SNX14 Antibody, sorting nexin 14 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017639-25 Anti-SNX14 Antibody, sorting nexin 14 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SNX14 Antibody

Anti-SNX14 Antibody

Target Information

  • Target Protein: Sorting Nexin 14
  • Target Gene: SNX14
  • Alternative Gene Names: RGS-PX2

Product Description

Polyclonal antibody against human SNX14. Designed for use in immunohistochemistry (IHC) and western blot (WB) applications.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LFRFMNFLKQEGAVHVLQFCLTVEEFNDRILRPELSNDEMLSLHEELQKIYKTYCLDESIDKIRFDPFIVEEIQRIAEGPYIDVVKLQTMRCLFEAYEHVLSLLENVFTPMFCHSDEYFRQLLRGAESPTRN

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Species Gene ID Antigen Sequence Identity
Rat ENSRNOG00000011348 100%
Mouse ENSMUSG00000032422 100%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet
Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.