CacheBy
Atlas Antibodies Anti-SNX14 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SNX14 Antibody

상품 한눈에 보기

Human SNX14 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC 및 WB 실험에 적합. Rabbit host 기반 IgG 형식으로 제작. PrEST 항원으로 친화 정제되어 높은 특이성 보유. Human, Mouse, Rat 반응성 검증 완료.

카탈로그번호
HPA017639-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA017639-100 Anti-SNX14 Antibody, sorting nexin 14 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017639-25 Anti-SNX14 Antibody, sorting nexin 14 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SNX14 Antibody

Anti-SNX14 Antibody

Target Information

  • Target Protein: Sorting Nexin 14
  • Target Gene: SNX14
  • Alternative Gene Names: RGS-PX2

Product Description

Polyclonal antibody against human SNX14. Designed for use in immunohistochemistry (IHC) and western blot (WB) applications.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LFRFMNFLKQEGAVHVLQFCLTVEEFNDRILRPELSNDEMLSLHEELQKIYKTYCLDESIDKIRFDPFIVEEIQRIAEGPYIDVVKLQTMRCLFEAYEHVLSLLENVFTPMFCHSDEYFRQLLRGAESPTRN

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Species Gene ID Antigen Sequence Identity
Rat ENSRNOG00000011348 100%
Mouse ENSMUSG00000032422 100%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet
Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.