CacheBy
Atlas Antibodies Anti-SNRPD1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SNRPD1 Antibody

상품 한눈에 보기

Human SNRPD1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit 호스트에서 생산되었으며 PrEST 항원을 이용해 친화 정제되었습니다. Human, Rat, Mouse에서 반응성이 검증되었습니다.

카탈로그번호
HPA040516-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040516-100 Anti-SNRPD1 Antibody, small nuclear ribonucleoprotein D1 polypeptide 16kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040516-25 Anti-SNRPD1 Antibody, small nuclear ribonucleoprotein D1 polypeptide 16kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SNRPD1 Antibody

Anti-SNRPD1 Antibody

Target Protein: small nuclear ribonucleoprotein D1 polypeptide 16kDa

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human SNRPD1.

Alternative Gene Names

HsT2456, Sm-D1, SNRPD

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein small nuclear ribonucleoprotein D1 polypeptide 16kDa
Target Gene SNRPD1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGR
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000013714 (100%), Mouse ENSMUSG00000002477 (100%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.