CacheBy
Atlas Antibodies Anti-SNRPC Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SNRPC Antibody

상품 한눈에 보기

Human SNRPC 단백질을 인식하는 토끼 폴리클로날 항체로, small nuclear ribonucleoprotein polypeptide C 검출에 적합합니다. Affinity purification 방식으로 정제되었으며, ICC 등 다양한 응용에 사용 가능합니다. Human에 대해 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA042419-100 Anti-SNRPC Antibody, small nuclear ribonucleoprotein polypeptide C 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042419-25 Anti-SNRPC Antibody, small nuclear ribonucleoprotein polypeptide C 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SNRPC Antibody

Anti-SNRPC Antibody

Target: small nuclear ribonucleoprotein polypeptide C
Supplier: Atlas Antibodies


  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human SNRPC.


Alternative Gene Names

  • U1-C
  • Yhc1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein small nuclear ribonucleoprotein polypeptide C
Target Gene SNRPC
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence MNSASVDGHLSGCRLFLFLSPLFRFYCDYCDTYLTHDSPSVRKTHCSGRKHKEN
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000024217 (56%), Rat ENSRNOG00000000493 (56%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.