CacheBy
Atlas Antibodies Anti-SMIM8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SMIM8 Antibody

상품 한눈에 보기

인간 SMIM8 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인체 특이성이 검증된 고품질 연구용 항체입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA007401-100 Anti-SMIM8 Antibody, small integral membrane protein 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007401-25 Anti-SMIM8 Antibody, small integral membrane protein 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SMIM8 Antibody

Anti-SMIM8 Antibody

Target Protein: small integral membrane protein 8 (SMIM8)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human SMIM8.


Alternative Gene Names

  • C6orf162
  • dJ102H19.2
  • DKFZP586E1923

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein small integral membrane protein 8
Target Gene SMIM8
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000028295 (83%), Rat ENSRNOG00000023035 (79%)

Antigen Sequence:
MSSAPEPPTFKKEPPKEKEFQSPGLRGVRTTTLFRAVNPELFIKPNKP


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.