CacheBy
Atlas Antibodies Anti-SMIM9 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SMIM9 Antibody

상품 한눈에 보기

Human SMIM9 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 연구용 응용에 적합. PrEST 항원을 이용한 친화정제 방식으로 제조되었으며, 고순도와 재현성이 우수. CXorf68로도 알려진 SMIM9 단백질 연구에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA060970-100 Anti-SMIM9 Antibody, small integral membrane protein 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060970-25 Anti-SMIM9 Antibody, small integral membrane protein 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SMIM9 Antibody

Anti-SMIM9 Antibody

Target Information

  • Target Protein: small integral membrane protein 9
  • Target Gene: SMIM9
  • Alternative Gene Names: CXorf68

Product Description

Polyclonal Antibody against Human SMIM9.

  • Immunohistochemistry (IHC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

SSPLPLSALGIQEKTGSKPRSGGNHRSWLNNFRDYLWQLIKSALPP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000013928 (33%)
  • Mouse ENSMUSG00000054889 (33%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.