CacheBy
Atlas Antibodies Anti-SLCO6A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLCO6A1 Antibody

상품 한눈에 보기

Human SLCO6A1 단백질을 인식하는 폴리클로날 항체로, IHC 및 오쏘고날 검증에 적합합니다. Rabbit 유래 IgG로 PrEST 항원 기반 정제. 인체 반응성이 검증되어 신뢰성 높은 단백질 발현 분석에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA054126-100 Anti-SLCO6A1 Antibody, solute carrier organic anion transporter family, member 6A1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054126-25 Anti-SLCO6A1 Antibody, solute carrier organic anion transporter family, member 6A1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLCO6A1 Antibody

Anti-SLCO6A1 Antibody

solute carrier organic anion transporter family, member 6A1


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human SLCO6A1.


Alternative Gene Names

CT48, MGC26949, OATP6A1, OATPY

Open Datasheet


Target Information

항목 내용
Target Protein solute carrier organic anion transporter family, member 6A1
Target Gene SLCO6A1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence AGCTYSKAQNQKKMYYNCSCIKEGLITADAEGDFIDARPGKCDAKCYKLPL
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000019252 (63%), Mouse ENSMUSG00000026331 (61%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.