CacheBy
Atlas Antibodies Anti-SLCO2A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLCO2A1 Antibody

상품 한눈에 보기

Human SLCO2A1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC Orthogonal 검증을 통해 신뢰성 확보. Affinity purification 방식으로 제조되었으며, 인간 시료에 적합. 다양한 응용에 사용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA013742-100 Anti-SLCO2A1 Antibody, solute carrier organic anion transporter family, member 2A1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA013742-25 Anti-SLCO2A1 Antibody, solute carrier organic anion transporter family, member 2A1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLCO2A1 Antibody

Anti-SLCO2A1 Antibody

Solute carrier organic anion transporter family, member 2A1


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human SLCO2A1


Alternative Gene Names

MATR1, OATP2A1, PGT, SLC21A2

Open Datasheet


Target Information

항목 내용
Target Protein Solute carrier organic anion transporter family, member 2A1
Target Gene SLCO2A1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence PSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSPCHAGCSNINMSSATSKQLIYLNCSCVTGGSASAKTGSCPVPCAH

Species Reactivity

항목 내용
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000032548 (84%), Rat ENSRNOG00000009005 (81%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.