CacheBy
Atlas Antibodies Anti-SLCO1A2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLCO1A2 Antibody

상품 한눈에 보기

Human SLCO1A2 단백질을 인식하는 폴리클로날 항체로, WB 및 ICC에 적합합니다. Rabbit에서 생산된 IgG 형태이며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 반응하며, 40% glycerol/PBS buffer에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA071152-100 Anti-SLCO1A2 Antibody, solute carrier organic anion transporter family, member 1A2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA071152-25 Anti-SLCO1A2 Antibody, solute carrier organic anion transporter family, member 1A2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLCO1A2 Antibody

Anti-SLCO1A2 Antibody

Target: solute carrier organic anion transporter family, member 1A2 (SLCO1A2)
Type: Polyclonal Antibody against Human SLCO1A2


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Alternative Gene Names

OATP, OATP-A, OATP1A2, SLC21A3

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein solute carrier organic anion transporter family, member 1A2
Target Gene SLCO1A2
Verified Species Reactivity Human
Interspecies Homology Mouse (65%), Rat (63%)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
Antigen Sequence:

FLPNTLPKEGLETNADIIKNENEDKQKEEVKKEKYGITKDFLPFMKSLSCN

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.