CacheBy
Atlas Antibodies Anti-SLC9A9 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC9A9 Antibody

상품 한눈에 보기

인간 SLC9A9 단백질을 인식하는 토끼 유래 다클론 항체로, IHC 등 다양한 연구 응용에 적합합니다. PrEST 항원으로 특이적으로 정제되었으며, 인간에 대해 검증된 반응성을 보입니다. PBS/글리세롤 버퍼로 안정화되어 장기 보관이 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA058234-100 Anti-SLC9A9 Antibody, solute carrier family 9, subfamily A (NHE9, cation proton antiporter 9), member 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058234-25 Anti-SLC9A9 Antibody, solute carrier family 9, subfamily A (NHE9, cation proton antiporter 9), member 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC9A9 Antibody

Anti-SLC9A9 Antibody

Target: solute carrier family 9, subfamily A (NHE9, cation proton antiporter 9), member 9
Supplier: Atlas Antibodies


면역조직화학 (IHC)


Product Description

Polyclonal antibody against Human SLC9A9


Alternative Gene Names

FLJ35613, NHE9

Open Datasheet


Target Information

항목 내용
Target Protein solute carrier family 9, subfamily A (NHE9, cation proton antiporter 9), member 9
Target Gene SLC9A9
Verified Species Reactivity Human
Interspecies Identity Rat (87%, ENSRNOG00000008554), Mouse (85%, ENSMUSG00000031129)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

TDIESGTVYDCVKLTFSPSTLLVNITDQVYEYKYKREISQHNINPHQGNAIL

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적 농도 및 조건은 사용자가 실험 목적에 따라 결정해야 합니다.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.