CacheBy
Atlas Antibodies Anti-SLC9A7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC9A7 Antibody

상품 한눈에 보기

Human SLC9A7 단백질을 표적으로 하는 토끼 폴리클로날 항체. NHE7 (cation proton antiporter 7) 검출에 적합. Affinity purification으로 높은 특이성 확보. 인체 반응성 검증 완료, Rat 및 Mouse와 92% 서열 동일성.

카탈로그번호
HPA048938-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA048938-100 Anti-SLC9A7 Antibody, solute carrier family 9, subfamily A (NHE7, cation proton antiporter 7), member 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048938-25 Anti-SLC9A7 Antibody, solute carrier family 9, subfamily A (NHE7, cation proton antiporter 7), member 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC9A7 Antibody

Anti-SLC9A7 Antibody

Target Protein: solute carrier family 9, subfamily A (NHE7, cation proton antiporter 7), member 7
Alternative Gene Name: NHE7
Supplier: Atlas Antibodies


면역조직화학(IHC)


Product Description

Polyclonal antibody against human SLC9A7.


Target Information

항목 내용
Target Gene SLC9A7
Target Protein solute carrier family 9, subfamily A (NHE7, cation proton antiporter 7), member 7
Alternative Gene Names NHE7
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000004150 (92%)
Mouse ENSMUSG00000037341 (92%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

QVYDNQEPLREEDSDFILTEGDLTLTYGDSTVTANGSSSSHTASTSLEGSRRT

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.