CacheBy
Atlas Antibodies Anti-SLC9A7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC9A7 Antibody

상품 한눈에 보기

Human SLC9A7 단백질을 표적으로 하는 토끼 폴리클로날 항체. NHE7 (cation proton antiporter 7) 검출에 적합. Affinity purification으로 높은 특이성 확보. 인체 반응성 검증 완료, Rat 및 Mouse와 92% 서열 동일성.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA048938-100 Anti-SLC9A7 Antibody, solute carrier family 9, subfamily A (NHE7, cation proton antiporter 7), member 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048938-25 Anti-SLC9A7 Antibody, solute carrier family 9, subfamily A (NHE7, cation proton antiporter 7), member 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC9A7 Antibody

Anti-SLC9A7 Antibody

Target Protein: solute carrier family 9, subfamily A (NHE7, cation proton antiporter 7), member 7
Alternative Gene Name: NHE7
Supplier: Atlas Antibodies


면역조직화학(IHC)


Product Description

Polyclonal antibody against human SLC9A7.


Target Information

항목 내용
Target Gene SLC9A7
Target Protein solute carrier family 9, subfamily A (NHE7, cation proton antiporter 7), member 7
Alternative Gene Names NHE7
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000004150 (92%)
Mouse ENSMUSG00000037341 (92%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

QVYDNQEPLREEDSDFILTEGDLTLTYGDSTVTANGSSSSHTASTSLEGSRRT

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.