CacheBy
Atlas Antibodies Anti-SLC9A5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC9A5 Antibody

상품 한눈에 보기

인간 SLC9A5 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 및 ICC에 적합하며 PrEST 항원으로 친화 정제되었습니다. NHE5로 알려진 SLC9A5 유전자에 특이적이며 높은 종간 서열 유사성을 보입니다. 안정한 PBS/glycerol 버퍼에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA041004-100 Anti-SLC9A5 Antibody, solute carrier family 9, subfamily A (NHE5, cation proton antiporter 5), member 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041004-25 Anti-SLC9A5 Antibody, solute carrier family 9, subfamily A (NHE5, cation proton antiporter 5), member 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC9A5 Antibody

Anti-SLC9A5 Antibody

Target: solute carrier family 9, subfamily A (NHE5, cation proton antiporter 5), member 5
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SLC9A5.

Alternative Gene Names

  • NHE5

Open Datasheet

Target Information

항목 내용
Target Protein solute carrier family 9, subfamily A (NHE5, cation proton antiporter 5), member 5
Target Gene SLC9A5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000028844 (87%), Mouse ENSMUSG00000014786 (86%)

Antigen Sequence:
ASPPCNQAPILTCLPPHPRGTEEPQVPLHLPSDPRSSFAFPPSLAKAGRSRSESSADLPQQQELQPLMGHKDHTHL

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.