원본

Atlas Antibodies Anti-FGFR4 Antibody

상품 한눈에 보기

인간 FGFR4 단백질을 인식하는 폴리클로나 항체로, IHC 및 WB에서 사용 가능. 재조합 발현 검증 완료. 토끼에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제됨. 인간 반응성 확인 및 마우스·랫에서 높은 상동성 보유.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA027273-100 Anti-FGFR4 Antibody, fibroblast growth factor receptor 4 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA027273-25 Anti-FGFR4 Antibody, fibroblast growth factor receptor 4 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Fibroblast Growth Factor Receptor 4 (FGFR4)

IHC (Immunohistochemistry)
WB (Western Blot) – Recombinant expression validation using target protein overexpression

Polyclonal antibody against human FGFR4.

항목	내용
Target Protein	Fibroblast growth factor receptor 4
Target Gene	FGFR4
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse (91%), Rat (91%)

Antigen Sequence:

VEALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDSVFSHDPLPLGSSSF

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand