CacheBy
Atlas Antibodies Anti-FGFR4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FGFR4 Antibody

상품 한눈에 보기

인체 FGFR4 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 검증에 적합합니다. 재조합 발현 검증 완료된 고품질 항체이며, 토끼 유래 IgG 형식으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027369-100 Anti-FGFR4 Antibody, fibroblast growth factor receptor 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027369-25 Anti-FGFR4 Antibody, fibroblast growth factor receptor 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FGFR4 Antibody

Anti-FGFR4 Antibody

Target: Fibroblast Growth Factor Receptor 4 (FGFR4)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant expression validation using target protein overexpression

Product Description

Polyclonal antibody against human FGFR4.


Alternative Gene Names

  • CD334
  • JTK2

Open Datasheet


Antigen Information

Antigen Sequence (PrEST antigen):
VEALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDSVFSHDPLPLGSSSF


Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000016763 91%
Mouse ENSMUSG00000005320 91%

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.