
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-FGFR4 Antibody
상품 한눈에 보기
인체 FGFR4 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 검증에 적합합니다. 재조합 발현 검증 완료된 고품질 항체이며, 토끼 유래 IgG 형식으로 높은 특이성과 재현성을 제공합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA027369-100 Anti-FGFR4 Antibody, fibroblast growth factor receptor 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027369-25 Anti-FGFR4 Antibody, fibroblast growth factor receptor 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-FGFR4 Antibody
Anti-FGFR4 Antibody
Target: Fibroblast Growth Factor Receptor 4 (FGFR4)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Recombinant expression validation using target protein overexpression
Product Description
Polyclonal antibody against human FGFR4.
Alternative Gene Names
- CD334
- JTK2
Antigen Information
Antigen Sequence (PrEST antigen):
VEALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDSVFSHDPLPLGSSSF
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000016763 | 91% |
| Mouse | ENSMUSG00000005320 | 91% |
Technical Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



