AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-FGFBP2 Antibody
상품 한눈에 보기
인간 FGFBP2에 특이적인 폴리클로날 항체로, IHC 및 WB(재조합 발현) 검증 완료. Rabbit 유래 IgG이며 PrEST 항원으로 친화 정제됨. 인간 반응성 확인, 마우스·랫과 낮은 교차 반응성. 40% 글리세롤 및 PBS 완충액 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA039180-100 Anti-FGFBP2 Antibody, fibroblast growth factor binding protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039180-25 Anti-FGFBP2 Antibody, fibroblast growth factor binding protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-FGFBP2 Antibody
Anti-FGFBP2 Antibody
Target: Fibroblast Growth Factor Binding Protein 2 (FGFBP2)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Recombinant expression validation using target protein overexpression
Product Description
Polyclonal antibody against Human FGFBP2.
Alternative Gene Names
- KSP37
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
PVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTR
Verified Species Reactivity
| Species | Reactivity |
|---|---|
| Human | Verified |
Interspecies Information
| Species | Ortholog Gene ID | Identity (%) |
|---|---|---|
| Mouse | ENSMUSG00000033088 | 31% |
| Rat | ENSRNOG00000055226 | 30% |
Specifications
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.