CacheBy
Atlas Antibodies Anti-FGFR1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FGFR1 Antibody

상품 한눈에 보기

Human FGFR1을 인식하는 polyclonal rabbit antibody로 IHC 및 Western blot에 적합. PrEST 항원을 이용해 affinity purification 수행. 높은 종간 반응성(인간, 쥐, 생쥐). 안정적인 PBS/glycerol buffer에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056402-100 Anti-FGFR1 Antibody, fibroblast growth factor receptor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056402-25 Anti-FGFR1 Antibody, fibroblast growth factor receptor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FGFR1 Antibody

Anti-FGFR1 Antibody

Target: fibroblast growth factor receptor 1 (FGFR1)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human FGFR1.

Alternative Gene Names

BFGFR, CD331, CEK, FLG, FLT2, H2, H3, H4, H5, KAL2, N-SAM

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Fibroblast Growth Factor Receptor 1
Target Gene FGFR1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000016050 (96%), Mouse ENSMUSG00000031565 (94%)

Antigen Sequence:

LPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTR

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.