Atlas Antibodies Anti-FASN Antibody

상품 한눈에 보기

인간 FASN 단백질을 인식하는 토끼 유래 폴리클로날 항체로, IHC 및 WB에서 단백질 발현 검증에 적합. Orthogonal 및 Independent validation 수행. 고순도 Affinity 정제 방식으로 높은 특이성과 재현성을 보장.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA006461-100 Anti-FASN Antibody, fatty acid synthase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA006461-25 Anti-FASN Antibody, fatty acid synthase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Fatty acid synthase (FASN)
Supplier: Atlas Antibodies

IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB Independent Validation: Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC: Suitable for immunocytochemistry.

Polyclonal antibody against Human FASN

FAS, SDR27X1

항목	내용
Target Protein	Fatty acid synthase
Target Gene	FASN
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000045636 (68%), Mouse ENSMUSG00000025153 (64%)

Antigen Sequence:
RWLRVTVAGGVHISGLHTESAPRRQQEQQVPILEKFCFTPHTEEGCLSERAALQEELQLCKGLVQALQTKVTQQGLKMVVPGLDGAQIPRDPSQQELPRLLSAACRLQLNGN

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand