
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-FASLG Antibody
상품 한눈에 보기
휴먼 FASLG 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 등 다양한 연구용 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 신뢰성 제공. Human에 대한 검증 완료.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA054959-100 Anti-FASLG Antibody, Fas ligand (TNF superfamily, member 6) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054959-25 Anti-FASLG Antibody, Fas ligand (TNF superfamily, member 6) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-FASLG Antibody
Anti-FASLG Antibody
Target Information
- Target Protein: Fas ligand (TNF superfamily, member 6)
- Target Gene: FASLG
- Alternative Gene Names: APT1LG1, CD178, FasL, TNFSF6
Product Description
Polyclonal antibody against human FASLG, produced in rabbit. Suitable for immunohistochemistry and related applications.
Recommended Applications
- Immunohistochemistry (IHC)
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
HTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFV
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000000817 | 76% |
| Rat | ENSRNOG00000002978 | 71% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Storage | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Safety Information
Material Safety Data Sheet (MSDS)
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



