CacheBy
Atlas Antibodies Anti-FASLG Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FASLG Antibody

상품 한눈에 보기

휴먼 FASLG 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 등 다양한 연구용 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 신뢰성 제공. Human에 대한 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA054959-100 Anti-FASLG Antibody, Fas ligand (TNF superfamily, member 6) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054959-25 Anti-FASLG Antibody, Fas ligand (TNF superfamily, member 6) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FASLG Antibody

Anti-FASLG Antibody

Target Information

  • Target Protein: Fas ligand (TNF superfamily, member 6)
  • Target Gene: FASLG
  • Alternative Gene Names: APT1LG1, CD178, FasL, TNFSF6

Product Description

Polyclonal antibody against human FASLG, produced in rabbit. Suitable for immunohistochemistry and related applications.

  • Immunohistochemistry (IHC)

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    HTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFV

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000000817 76%
Rat ENSRNOG00000002978 71%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Storage Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Safety Information

Material Safety Data Sheet (MSDS)

Additional Resources

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.