
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-EXOSC3 Antibody
상품 한눈에 보기
Human EXOSC3 단백질을 인식하는 rabbit polyclonal antibody로, IHC, WB, ICC 등 다양한 응용에 적합함. Orthogonal 및 recombinant expression 검증을 거친 고품질 항체. Affinity purification으로 높은 특이성과 재현성 보장.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA020485-100 Anti-EXOSC3 Antibody, exosome component 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020485-25 Anti-EXOSC3 Antibody, exosome component 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-EXOSC3 Antibody
Anti-EXOSC3 Antibody
Target: Exosome component 3 (EXOSC3)
Type: Polyclonal antibody against Human EXOSC3
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Recombinant expression validation): Recombinant expression validation in WB using target protein overexpression.
- ICC: Immunocytochemistry application validated.
Product Description
Polyclonal antibody against human EXOSC3.
Alternative Gene Names
CGI-102, hRrp-40, hRrp40p, p10, RRP40, Rrp40p
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Exosome component 3 |
| Target Gene | EXOSC3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | VYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKD |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000028322 (96%), Rat ENSRNOG00000012409 (96%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Safety Data | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



