AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-EXOSC10 Antibody
상품 한눈에 보기
Human EXOSC10 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB 검증에 적합. siRNA knockdown으로 유전적 검증 완료. PrEST 항원을 이용한 친화 정제 방식. 40% glycerol 및 PBS buffer로 안정화.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA028484-100 Anti-EXOSC10 Antibody, exosome component 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028484-25 Anti-EXOSC10 Antibody, exosome component 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-EXOSC10 Antibody
Anti-EXOSC10 Antibody
Target: exosome component 10
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Genetic validation in WB by siRNA knockdown
Product Description
Polyclonal antibody against Human EXOSC10.
Alternative Gene Names
p2, p3, p4, PM-Scl, PM/Scl-100, PMSCL2, RRP6, Rrp6p
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | exosome component 10 |
| Target Gene | EXOSC10 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | KVTELEDKFDLLVDANDVILERVGILLDEASGVNKNQQPVLPAGLQVPKTVVSSWNRKAAEYGKKAKSETFRLLHA |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000017264 | 93% |
| Rat | ENSRNOG00000010719 | 93% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.