AI 생성

1 / 2

Atlas Antibodies Anti-ETV6 Antibody

상품 한눈에 보기

Human ETV6 단백질을 표적으로 하는 토끼 폴리클로날 항체로, IHC 및 WB에서 RNA-seq 데이터 기반의 orthogonal validation 수행. TEL 유전자의 단백질 발현 분석에 적합하며, PrEST 항원으로 정제된 고품질 항체.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA000264-100 Anti-ETV6 Antibody, ets variant 6 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA000264-25 Anti-ETV6 Antibody, ets variant 6 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: ets variant 6 (ETV6, TEL)
Type: Polyclonal Antibody against Human ETV6
Supplier: Atlas Antibodies

IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Polyclonal antibody generated in rabbit against human ETV6 protein.

항목	내용
Target Protein	ets variant 6
Target Gene	ETV6
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000005984 (92%), Mouse ENSMUSG00000030199 (87%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

NGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQRKPRILFSPFFHPGNSIHTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLHRSRSPITTNHRPSPDPEQRPLRSPLDNMIR

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
Material Safety Data Sheet

Enhanced Validation
IHC Orthogonal
WB Orthogonal
ICC

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.